PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.3G373000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family G2-like
Protein Properties Length: 373aa    MW: 39705.2 Da    PI: 7.5708
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.3G373000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.31.2e-31102155255
             G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         pr+rWt+ LH++Fv+ave LGG+e+AtPk++le+m+vk+Ltl+hvkSHLQ+YR+
  Seita.3G373000.1.p 102 PRMRWTTALHAHFVHAVELLGGHERATPKSVLEMMNVKDLTLAHVKSHLQMYRT 155
                         9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.0E-28100155IPR009057Homeodomain-like
SuperFamilySSF466892.51E-15100155IPR009057Homeodomain-like
TIGRFAMsTIGR015576.0E-23102155IPR006447Myb domain, plants
PfamPF002491.3E-7103154IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 373 aa     Download sequence    Send to blast
MSTTTSRVTA TTATPDLSLH ISPPSPAAAA GEMQAAEPRL LLGLELDTAA PAAAKTDDAA  60
AQRHGGVHQV QQRLHQPNQT AHGLKKSSGG GGGGGRRSAR APRMRWTTAL HAHFVHAVEL  120
LGGHERATPK SVLEMMNVKD LTLAHVKSHL QMYRTVKGTD RSCIAGHGQA RDMVFLRRRG  180
SAGEVDGFDV FNSNYAVNTT TIFNNNTPSS DELALQPWPC RLRPAADRLL MTTATEQSQG  240
LKVGEQDNNH GQGAVALHHL AEAEAREKVS SPQAPTPRDY AGSGGFHRPS PNNTSSSGDD  300
TVSSSEWPPL QQDYGNDGGM MTVRVVASHA PPPSLEMSLG RQGWQVEHQR VGVEFESSSP  360
PAANELTLLK CL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP1002031e-95FP100203.1 Phyllostachys edulis cDNA clone: bphylf053h02, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004963044.10.0PREDICTED: uncharacterized protein LOC101780383
TrEMBLK3ZDP41e-150K3ZDP4_SETIT; Uncharacterized protein
STRINGSi024683m1e-150(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP37423168
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42630.26e-33G2-like family protein